WDR77 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82778

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SEDCSIAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WDR77 Antibody - BSA Free

Western Blot: WDR77 Antibody [NBP1-82778]

Western Blot: WDR77 Antibody [NBP1-82778]

Western Blot: WDR77 Antibody [NBP1-82778] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: WDR77 Antibody [NBP1-82778]

Immunocytochemistry/ Immunofluorescence: WDR77 Antibody [NBP1-82778]

Immunocytochemistry/Immunofluorescence: WDR77 Antibody [NBP1-82778] - Staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778] - Staining of human rectum shows weak to moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: WDR77 Antibody [NBP1-82778]

Western Blot: WDR77 Antibody [NBP1-82778]

Western Blot: WDR77 Antibody [NBP1-82778] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778] - Staining of human fallopian tube shows cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778]

Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.

Applications for WDR77 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR77

WDR77 is a component of the 20S PRMT5 (MIM 604045)-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins (see MIM 601061). This modification targets Sm proteins to the survival of motor neurons (SMN) complex (see MIM 600354) for assembly into small nuclear ribonucleoprotein core particles (Friesen et al., 2002 [PubMed 11756452]).[supplied by OMIM]

Alternate Names

Androgen receptor cofactor p44, MEP-50, MEP50Nbla10071, methylosome protein 50, MGC2722, p44, p44/Mep50, RP11-552M11.3, WD repeat domain 77, WD repeat-containing protein 77

Gene Symbol

WDR77

Additional WDR77 Products

Product Documents for WDR77 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR77 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR77 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR77 Antibody - BSA Free and earn rewards!

Have you used WDR77 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WDR77 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I have seen that the peptide from which was raised the antibody NBP1-82778 is 85% homologous in mice. My question is: is this antibody working for IHC also in mouse or not?

    A:

    NBP1-82778 has never been tested in mouse, however, since the immunogen shares 88% similarity with mouse, it is predicted to cross-react since it is a polyclonal antibody. You would be glad to learn that for untested species or applications, we offer our Innovator's Reward program. When you submit a review of your experiment, we will supply you with a credit for the purchase price of the antibody. Contact us for more information at innovators@novusbio.com.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...