YB1 Antibody (9J7M4)

Novus Biologicals | Catalog # NBP3-16213

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9J7M4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB1 (P67809). GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for YB1 Antibody (9J7M4)

Western Blot: YB1 Antibody (9J7M4) [NBP3-16213]

Western Blot: YB1 Antibody (9J7M4) [NBP3-16213]

Western Blot: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of extracts of various cell lines, using YB1 Rabbit mAb (NBP3-16213) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: YB1 Antibody (9J7M4) [NBP3-16213]

Western Blot: YB1 Antibody (9J7M4) [NBP3-16213]

Western Blot: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of extracts of HeLa cells, using YB1 Rabbit mAb (NBP3-16213) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
YB1 Antibody (9J7M4)

Immunoprecipitation: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunoprecipitation: YB1 Antibody (9J7M4) [NBP3-16213] - Immunoprecipitation of YB1 from 200 ug extracts of HeLa cells was performed using 0.5 ug of YB1 Rabbit mAb. Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using YB1 Rabbit mAb at a dilution of 1:1000.
YB1 Antibody (9J7M4)

Immunocytochemistry/ Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunocytochemistry/ Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Confocal imaging of NIH/3T3 cells using YB1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
YB1 Antibody (9J7M4)

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using YB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YB1 Antibody (9J7M4)

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] - Immunohistochemistry analysis of paraffin-embedded Human colon using YB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YB1 Antibody (9J7M4)

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using YB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YB1 Antibody (9J7M4)

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] - Immunohistochemistry analysis of paraffin-embedded Rat colon using YB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YB1 Antibody (9J7M4)

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunohistochemistry: YB1 Antibody (9J7M4) [NBP3-16213] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using YB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YB1 Antibody (9J7M4)

Immunocytochemistry/ Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] -

Immunocytochemistry/ Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Confocal imaging of U-2 OS cells using YB1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for YB1 Antibody (9J7M4)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

1:500 - 1:1000

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: YB1

The Y-box binding protein 1 (YB1) is a pluripotent DNA/RNA-binding factor which regulates gene expression through transcription and translation. YB1 has been shown to be a marker of tumor aggressiveness and belongs to the cold-shock domain family.

Alternate Names

BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1

Gene Symbol

YBX1

Additional YB1 Products

Product Documents for YB1 Antibody (9J7M4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for YB1 Antibody (9J7M4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for YB1 Antibody (9J7M4)

There are currently no reviews for this product. Be the first to review YB1 Antibody (9J7M4) and earn rewards!

Have you used YB1 Antibody (9J7M4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...