YIPF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86765

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all YIPF3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (86%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for YIPF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: YIPF3 Antibody [NBP1-86765]

Immunocytochemistry/ Immunofluorescence: YIPF3 Antibody [NBP1-86765]

Immunocytochemistry/Immunofluorescence: YIPF3 Antibody [NBP1-86765] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: YIPF3 Antibody [NBP1-86765]

Immunohistochemistry-Paraffin: YIPF3 Antibody [NBP1-86765]

Immunohistochemistry-Paraffin: YIPF3 Antibody [NBP1-86765] - Staining of human epididymis shows cytoplasmic positivity in glandular cells.
YIPF3 Antibody

Western Blot: Rabbit Polyclonal YIPF3 Antibody [NBP1-86765]

Western Blot: Rabbit Polyclonal YIPF3 Antibody [NBP1-86765] - YIPF3 W-B of the lysate VA-13 cells (mouse ADH1-transfected HepG2 cells): control, alcohol-treated. treated with YIPF3 siRNAs, and alcohol plus YIPF3 siRNAs. Beta-actin is a loading control. Image from a verified customer review.
YIPF3 Antibody - BSA Free Western Blot: YIPF3 Antibody - BSA Free [NBP1-86765]

Western Blot: YIPF3 Antibody - BSA Free [NBP1-86765]

Analysis in control (vector only transfected HEK293T lysate) and YIPF3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for YIPF3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-86765 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: YIPF3

YIPF3 may play a role in hematopoiesis

Alternate Names

C6orf109, chromosome 6 open reading frame 109, dJ337H4.3, FinGER3, Killer lineage protein 1, KLIP1DKFZp566C243, Natural killer cell-specific antigen KLIP1, protein YIPF3, Yip1 domain family, member 3, YIP1 family member 3

Gene Symbol

YIPF3

Additional YIPF3 Products

Product Documents for YIPF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for YIPF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for YIPF3 Antibody - BSA Free

Customer Reviews for YIPF3 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used YIPF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • YIPF3 Antibody
    Name: Armen Petrosyan
    Application: Western Blot
    Sample Tested: HepG2 hepatoma cells
    Species: Human
    Verified Customer | Posted 11/06/2024
    YIPF3 W-B of the lysate VA-13 cells (mouse ADH1-transfected HepG2 cells): control, alcohol-treated. treated with YIPF3 siRNAs, and alcohol plus YIPF3 siRNAs. Beta-actin is a loading control.
    YIPF3 Antibody - BSA Free NBP1-86765

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies