Zinc finger protein 324B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92614

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCTPGPGFLQGHHRKVRRGGKPSPVLKPAKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Zinc finger protein 324B Antibody - BSA Free

Western Blot: Zinc finger protein 324B Antibody [NBP1-92614]

Western Blot: Zinc finger protein 324B Antibody [NBP1-92614]

Western Blot: Zinc finger protein 324B Antibody [NBP1-92614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Zinc finger protein 324B Antibody [NBP1-92614]

Immunocytochemistry/ Immunofluorescence: Zinc finger protein 324B Antibody [NBP1-92614]

Immunocytochemistry/Immunofluorescence: Zinc finger protein 324B Antibody [NBP1-92614] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: Zinc finger protein 324B Antibody [NBP1-92614]

Immunohistochemistry-Paraffin: Zinc finger protein 324B Antibody [NBP1-92614]

Immunohistochemistry-Paraffin: Zinc finger protein 324B Antibody [NBP1-92614] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.
Zinc finger protein 324B Antibody - BSA Free Western Blot: Zinc finger protein 324B Antibody - BSA Free [NBP1-92614]

Western Blot: Zinc finger protein 324B Antibody - BSA Free [NBP1-92614]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for Zinc finger protein 324B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Zinc finger protein 324B

Zinc finger protein 324B may be involved in transcriptional regulation

Alternate Names

FLJ45850, zinc finger protein 324B

Gene Symbol

ZNF324B

Additional Zinc finger protein 324B Products

Product Documents for Zinc finger protein 324B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Zinc finger protein 324B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Zinc finger protein 324B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Zinc finger protein 324B Antibody - BSA Free and earn rewards!

Have you used Zinc finger protein 324B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...