Zinc finger protein 470 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84324

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KDPWVIKGGMNRGLCPDLECVWVTKSLSLNQDIYEEKLPPAIIMERLKSYDLECSTLGKNWKCEDLFE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Zinc finger protein 470 Antibody - BSA Free

Zinc finger protein 470 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Zinc finger protein 470 Antibody - BSA Free [NBP1-84324]

Immunocytochemistry/ Immunofluorescence: Zinc finger protein 470 Antibody - BSA Free [NBP1-84324]

Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Zinc finger protein 470 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: Zinc finger protein 470 Antibody - BSA Free [NBP1-84324]

Chromatin Immunoprecipitation-exo-Seq: Zinc finger protein 470 Antibody - BSA Free [NBP1-84324]

ChIP-Exo-Seq composite graph for Anti-ZNF470 (NBP1-84324) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
Zinc finger protein 470 Antibody - BSA Free Immunohistochemistry-Paraffin: Zinc finger protein 470 Antibody [NBP1-84324]

Immunohistochemistry-Paraffin: Zinc finger protein 470 Antibody [NBP1-84324]

Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Applications for Zinc finger protein 470 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Zinc finger protein 470

Zinc finger protein 470 may be involved in transcriptional regulation

Alternate Names

chondrogenesis zinc finger protein 1, CZF1, CZF-1, FLJ26175, FLJ26846, zinc finger protein 470

Gene Symbol

ZNF470

Additional Zinc finger protein 470 Products

Product Documents for Zinc finger protein 470 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Zinc finger protein 470 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Zinc finger protein 470 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Zinc finger protein 470 Antibody - BSA Free and earn rewards!

Have you used Zinc finger protein 470 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...