ZNF524 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13579

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: CRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF524 Antibody - BSA Free

Western Blot: ZNF524 Antibody [NBP2-13579]

Western Blot: ZNF524 Antibody [NBP2-13579]

Western Blot: ZNF524 Antibody [NBP2-13579] - Analysis in control (vector only transfected HEK293T lysate) and ZNF524 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: ZNF524 Antibody [NBP2-13579]

Immunocytochemistry/ Immunofluorescence: ZNF524 Antibody [NBP2-13579]

Immunocytochemistry/Immunofluorescence: ZNF524 Antibody [NBP2-13579] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF524 Antibody [NBP2-13579]

Immunohistochemistry-Paraffin: ZNF524 Antibody [NBP2-13579]

Immunohistochemistry-Paraffin: ZNF524 Antibody [NBP2-13579] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
ZNF524 Antibody - BSA Free Western Blot: ZNF524 Antibody - BSA Free [NBP2-13579]

Western Blot: ZNF524 Antibody - BSA Free [NBP2-13579]

Analysis in control (vector only transfected HEK293T lysate) and ZNF524 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
ZNF524 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZNF524 Antibody - BSA Free [NBP2-13579]

Chromatin Immunoprecipitation-exo-Seq: ZNF524 Antibody - BSA Free [NBP2-13579]

ChIP-Exo-Seq composite graph for Anti-ZNF524 (NBP2-13579) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ZNF524 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF524

ZNF524 may be involved in transcriptional regulation

Alternate Names

FPM315ZKSCAN12Zinc finger protein FPM315, zinc finger protein 263, Zinc finger protein with KRAB and SCAN domains 12

Gene Symbol

ZNF524

Additional ZNF524 Products

Product Documents for ZNF524 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF524 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF524 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF524 Antibody - BSA Free and earn rewards!

Have you used ZNF524 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...