ZNF574 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-04776
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human ZNF574 (NP_073589.4). PPVGQARVAVEHSYRKAEEGGEGATVPSAAATTTEVVTEVELLLYKCSECSQLFQLPADFLEHQATHFPAPVPESQEPALQQEVQASSPAEVPVSQPDPLPASDHSYELRNGEAIGRDRRGRRARRNNSGEAGGAATQELF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ZNF574 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence: ZNF574 Antibody - Azide and BSA Free [ZNF574] -
Immunocytochemistry/ Immunofluorescence: ZNF574 Antibody - Azide and BSA Free [ZNF574] - Immunofluorescence analysis of U-2 OS cells using ZNF574 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ZNF574 Antibody - Azide and BSA Free [ZNF574] -
Immunocytochemistry/ Immunofluorescence: ZNF574 Antibody - Azide and BSA Free [ZNF574] - Immunofluorescence analysis of NIH-3T3 cells using ZNF574 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.![Immunohistochemistry-Paraffin: ZNF574 Antibody - Azide and BSA Free [NBP3-04776]](https://resources.rndsystems.com/images/products/ZNF574-Antibody-Immunohistochemistry-Paraffin-NBP3-04776-img0003.jpg "Immunohistochemistry-Paraffin: ZNF574 Antibody - Azide and BSA Free [NBP3-04776]")
Immunohistochemistry-Paraffin: ZNF574 Antibody - Azide and BSA Free [NBP3-04776]
Immunohistochemistry-Paraffin: ZNF574 Antibody [NBP3-04776] - Immunohistochemistry of paraffin-embedded human stomach using ZNF574 antibody (NBP3-04776) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: ZNF574 Antibody - Azide and BSA Free [NBP3-04776]](https://resources.rndsystems.com/images/products/ZNF574%20Antibody-Immunohistochemistry-Paraffin-NBP3-04776-img0004.jpg "Immunohistochemistry-Paraffin: ZNF574 Antibody - Azide and BSA Free [NBP3-04776]")
Immunohistochemistry-Paraffin: ZNF574 Antibody - Azide and BSA Free [NBP3-04776]
Immunohistochemistry-Paraffin: ZNF574 Antibody [NBP3-04776] - Immunohistochemistry of paraffin-embedded mouse pancreas using ZNF574 antibody (NBP3-04776) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Applications for ZNF574 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Immunohistochemistry
1:50-1:200
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ZNF574
Alternate Names
FLJ22059, FP972, zinc finger protein 574
Gene Symbol
ZNF574
Additional ZNF574 Products
Product Documents for ZNF574 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ZNF574 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for ZNF574 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ZNF574 Antibody - Azide and BSA Free and earn rewards!
Have you used ZNF574 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...