11 beta-HSD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48879

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 11 beta-HSD1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 11 beta-HSD1 Antibody - BSA Free

Western Blot: 11 beta-HSD1 Antibody [NBP2-48879]

Western Blot: 11 beta-HSD1 Antibody [NBP2-48879]

Western Blot: 11 beta-HSD1 Antibody [NBP2-48879] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human pancreas shows negative cytoplasmic positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining in human liver and pancreas tissues using anti-HSD11B1 antibody. Corresponding HSD11B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879]

Immunohistochemistry-Paraffin: 11 beta-HSD1 Antibody [NBP2-48879] - Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.

Applications for 11 beta-HSD1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 11 beta-HSD1

HSD11B1 is encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.

Long Name

11 beta Hydroxysteroid Dehydrogenase 1

Alternate Names

11 betaHSD1, HSD11B1

Gene Symbol

HSD11B1

Additional 11 beta-HSD1 Products

Product Documents for 11 beta-HSD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 11 beta-HSD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 11 beta-HSD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 11 beta-HSD1 Antibody - BSA Free and earn rewards!

Have you used 11 beta-HSD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies