5-HT1F Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90319

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 5-HT1F Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 5-HT1F Antibody - BSA Free

5-HT1F Antibody - BSA Free Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
5-HT1F Antibody - BSA Free Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
5-HT1F Antibody - BSA Free Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
5-HT1F Antibody - BSA Free Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Immunohistochemistry: 5-HT1F Antibody - BSA Free [NBP1-90319]

Staining of human skin shows strong cytoplasmic positivity in basal cells.

Applications for 5-HT1F Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-HT1F

The members of the G protein-coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin and dopamine receptors. The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds. beta-adrenergic bound to adrenaline activates adenylyl cyclase, while alpha2-adrenergic receptor bound to adrenaline inhibits adenylyl cyclase. Like the alpha2-adrenergic receptor, serotonin receptor functions are also mediated by G proteins that inhibit the activity of adenylyl cyclase. The serotonin receptors have been classified into several categories, designated SR-17 (5HT17). Subtypes within the SR-1 group include SR-1A, -1B, -1D, -1E and -1F.

Long Name

5-Hydroxytryptamine Receptor 1F

Alternate Names

5HT1F, 5HT6, HTR1EL, HTR1F, MR77

Gene Symbol

HTR1F

Additional 5-HT1F Products

Product Documents for 5-HT1F Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 5-HT1F Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 5-HT1F Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 5-HT1F Antibody - BSA Free and earn rewards!

Have you used 5-HT1F Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies