5-HT3E Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82540

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human 5-HT3E. Peptide sequence: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit 5-HT3E Antibody - BSA Free (NBP2-82540) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for 5-HT3E Antibody - BSA Free

Western Blot: 5-HT3E Antibody [NBP2-82540]

Western Blot: 5-HT3E Antibody [NBP2-82540]

Western Blot: 5-HT3E Antibody [NBP2-82540] - WB Suggested Anti-HTR3E Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart
Immunohistochemistry: 5-HT3E Antibody [NBP2-82540]

Immunohistochemistry: 5-HT3E Antibody [NBP2-82540]

Immunohistochemistry: 5-HT3E Antibody [NBP2-82540] - Immunofluorescence -- Dilution: 1.3ug/mL

Applications for 5-HT3E Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-HT3E

The product of the HTR3E gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E ofthe type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, ahormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encodingsubunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its fulllength sequence has not been determined. (provided by RefSeq)

Long Name

5-Hydroxytryptamine Receptor 3E

Alternate Names

5-HT3c1, 5HT3E, HTR3E

Gene Symbol

HTR3E

Additional 5-HT3E Products

Product Documents for 5-HT3E Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 5-HT3E Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 5-HT3E Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 5-HT3E Antibody - BSA Free and earn rewards!

Have you used 5-HT3E Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...