5-HT4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14109

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSD

Reactivity Notes

Rat (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 5-HT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109]

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109]

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] - Analysis in human small intestine and liver tissues using NBP2-14109 antibody. Corresponding 5-HT4 RNA-seq data are presented for the same tissues.
5-HT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] -

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.
5-HT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] -

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] - Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.
5-HT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] -

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
5-HT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] -

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] - Staining of human liver shows no positivity in hepatocytes as expected.
5-HT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] -

Immunohistochemistry-Paraffin: 5-HT4 Antibody [NBP2-14109] - Staining of human tonsil shows no positivity in germinal and non-germinal center cells as expected.

Applications for 5-HT4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-HT4

The 5-HT4 receptor, a member of the Serotonin Receptor subfamily, has been shown to affect the sensory and motor functions of the gut. Some of the most promising emerging therapies in Irritable Bowel Syndrome revolve around targeted pharmacotherapeutic modulation of serotonin receptors (ie, 5-HT3 and 5-HT4 subtypes). At least 9 isoforms (5-HT4A-5-HT4G, and 5-HT4n) have been described, which differ in the length and composition of their intracellular C termini after a common splicing site (L358). A ninth isoform (5-HT4H) results in the insertion of 14 amino acids into the second intracellular loop. 5-HT4 receptor expression has been documented primarily in the brain, and in colon, heart, and vessel. An EST has been isolated from a human cancerous nerve library.

Long Name

5-Hydroxytryptamine Receptor 4

Alternate Names

5HT4, HTR4

Gene Symbol

HTR4

Additional 5-HT4 Products

Product Documents for 5-HT4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 5-HT4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 5-HT4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 5-HT4 Antibody - BSA Free and earn rewards!

Have you used 5-HT4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...