Recombinant Human ABCA1 GST (N-Term) Protein

Novus Biologicals | Catalog # H00000019-Q01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
View all ABCA1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 86-185 of Human ABCA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ABCA1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human ABCA1 GST (N-Term) Protein [H00000019-Q01]

SDS-PAGE: Recombinant Human ABCA1 GST (N-Term) Protein [H00000019-Q01]

SDS-Page: Recombinant Human ABCA1 Protein [H00000019-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00000019-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: ABCA1

ATP-binding cassette transporter A1 (ABCA1) is a cAMP-dependent and sulfonylurea-sensitive anion transporter belonging to the ATP-binding cassette family. ABCA1 is involved in the regulation of apolipoprotein AI (apoAI)-mediated cholesterol efflux and high-density lipoproteins (HDL) metabolism (1). In the brain, ABCA1 transports cholesterol to apoE, the major CNS apolipoprotein, where it influences motor function and synaptic morphology.

ABCA1 is comprised of 2,261 amino acids with a theoretical molecular weight of 254 kDa and human ABCA1 shares 97% amino acid identity with mouse ABCA1. The general structure of ABCA consists of two transmembrane domains (TMDs) and two nucleotide binding domains (NBDs). ABCA1 is a widely distributed cell-membrane protein with the highest expression found in macrophages. DHHC8 mediated palmitoylation of ABCA1 is essential for its localization to the plasma membrane and expression of mouse ABCA1 (not human) is induced by cAMP analogs (2). ABCA1 is phosphorylated at Ser1042 and Ser2054 by PKA, with Ser2054 being key for regulating phospholipid efflux. Mutations in ABCA1 have been linked to atherosclerosis and the progression of metabolic syndrome phenotypes: high density lipoprotein deficiency type 1 (HDLD1); also known as Tangier disease (TGD), and high density lipoprotein deficiency type 2 (HDLD2); also known as familial hypoalphalipoproteinemia (FHA) (3).

References

1.Oram JF, Lawn RM. (2001) ABCA1. The gatekeeper for eliminating excess tissue cholesterol. J Lipid Res. 42(8):1173-9. PMID: 11483617

2.Singaraja RR, Kang MH, Vaid K, Sanders SS, Vilas GL, Arstikaitis P, Coutinho J, Drisdel RC, El-Husseini Ael D, Green WN, Berthiaume L, Hayden MR. (2009) Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function. Circ Res. 105(2):138-47. PMID: 19556522

3.Attie AD. (2007) ABCA1: at the nexus of cholesterol, HDL and atherosclerosis. Trends in Biochemical Sciences 32(4):172-9. PMID: 17324574

Long Name

ATP-binding Cassette, Sub-family A (ABC1), Member 1

Alternate Names

ABC1, CERP, HDLDT1, TGD

Gene Symbol

ABCA1

Additional ABCA1 Products

Product Documents for Recombinant Human ABCA1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human ABCA1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Eicosanoids and Regulators

Customer Reviews for Recombinant Human ABCA1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human ABCA1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human ABCA1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human ABCA1 GST (N-Term) Protein

Showing  1 - 2 of 2 FAQs Showing All

  • Q: For Western blot protocol for ABCA1 antibody NB400-105, why does it suggest treating with beta-ME while not heating?

    A: For some membrane proteins it is not recommended to boil the samples. You may incubate them at room temperature or at 37C in SDS sample buffer with BME. However, from personal experience, if you boil the samples you will not see the protein on the blot. I do not think the exact reason is known.

  • Q: Our customer would like to consult something about the ABCA1 antibody with the Cat No. NB400-105. In the datasheet, it showed this protein expressed very low in most cell types. The customer may test the mouse liver tissues, and he doesn’t know the expression level of ABCA1 in this tissue. Is it necessary to induce the expression via LXR treatment to get enough protein expressed? If he doesn’t induce the expression, how much protein loaded was suitable as recommended?

    A: Our own Western blot data for NB400-105 was generated by treating RAW cells with 9-cis-retinoic acid and 22R-hydroxycholesterol, which are both known to induce expression of ABCA1 in macrophages. 40ug of protein was loaded on to the gel in this instance. Unfortunately we do not have any testing data from mouse liver tissues using this particular antibody, however the data for another of our ABCA1 antibodies may be of interest to your customer: NB100-2068. The Western blot data for this product was generated using mouse liver tissue, and a clear band can be seen at the expected molecular weight in wild type tissue. We loaded 30ug of protein when running this Western blot, however, your customer may need to optimise the staining procedure for their sample type.

  • Q: For Western blot protocol for ABCA1 antibody NB400-105, why does it suggest treating with beta-ME while not heating?

    A: For some membrane proteins it is not recommended to boil the samples. You may incubate them at room temperature or at 37C in SDS sample buffer with BME. However, from personal experience, if you boil the samples you will not see the protein on the blot. I do not think the exact reason is known.

  • Q: Our customer would like to consult something about the ABCA1 antibody with the Cat No. NB400-105. In the datasheet, it showed this protein expressed very low in most cell types. The customer may test the mouse liver tissues, and he doesn’t know the expression level of ABCA1 in this tissue. Is it necessary to induce the expression via LXR treatment to get enough protein expressed? If he doesn’t induce the expression, how much protein loaded was suitable as recommended?

    A: Our own Western blot data for NB400-105 was generated by treating RAW cells with 9-cis-retinoic acid and 22R-hydroxycholesterol, which are both known to induce expression of ABCA1 in macrophages. 40ug of protein was loaded on to the gel in this instance. Unfortunately we do not have any testing data from mouse liver tissues using this particular antibody, however the data for another of our ABCA1 antibodies may be of interest to your customer: NB100-2068. The Western blot data for this product was generated using mouse liver tissue, and a clear band can be seen at the expected molecular weight in wild type tissue. We loaded 30ug of protein when running this Western blot, however, your customer may need to optimise the staining procedure for their sample type.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes