ABCA7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14250

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ABCA7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCA7 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ABCA7 Antibody [NBP2-14250]

Immunocytochemistry/ Immunofluorescence: ABCA7 Antibody [NBP2-14250]

Immunocytochemistry/Immunofluorescence: ABCA7 Antibody [NBP2-14250] - Staining of human cell line A-431 shows localization to plasma membrane, the Golgi apparatus & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining in human bone marrow and skeletal muscle tissues. Corresponding ABCA7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human lymph node shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250]

Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human spleen shows strong cytoplasmic positivity in a subset of cells in red pulp.

Applications for ABCA7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA7

ATP-binding cassette sub-family A member 7 (ABCA7), is a member of the ATP-binding cassette sub-family A. ABCA7 is thought to have a role in phagocytosis apoptotic cells macrophages.

ABCA-7 is highly homologous to ABCA1, and also mediates cellular cholesterol and phospholipid release by apolipoproteins. The ABCA7 gene is regulated by sterol in the opposite direction to ABCA1 through SRE/SREBP2. The expression of ABCA7 by this regulation is associated with phagocytic activity. As well, it binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. It also may mediate cholesterol efflux.

ABCA7 antibodies are useful for studies of cholesterol formation and lipid processing mechanisms.

Alternate Names

ABCA-SSN, ABCXATP-binding cassette sub-family A member 7, ATP-binding cassette, sub-family A (ABC1), member 7, Autoantigen SS-N, EC 2.2.1.1, EC 3.6.3, EC 3.6.3.41, FLJ40025, Macrophage ABC transporter

Entrez Gene IDs

10347 (Human)

Gene Symbol

ABCA7

UniProt

Q8IZY2 (Human)

Additional ABCA7 Products

Product Documents for ABCA7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ABCA7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCA7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCA7 Antibody - BSA Free and earn rewards!

Have you used ABCA7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies