ACAA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55156

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACAA1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACAA1(acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)) The peptide sequence was selected from the N terminal of ACAA1. Peptide sequence ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD The peptide sequence for this immunogen was taken from within the described region.

Marker

Peroxisome Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACAA1 Antibody - BSA Free

Western Blot: ACAA1 Antibody [NBP1-55156]

Western Blot: ACAA1 Antibody [NBP1-55156]

Western Blot: ACAA1 Antibody [NBP1-55156] - Rat purified peroxisomes (33ug) at 1:1000.
Immunohistochemistry: ACAA1 Antibody [NBP1-55156]

Immunohistochemistry: ACAA1 Antibody [NBP1-55156]

Immunohistochemistry: ACAA1 Antibody [NBP1-55156] - Human Liver Tissue Observed Staining: Cytoplasm in granules of hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Western Blot: ACAA1 Antibody [NBP1-55156]

Western Blot: ACAA1 Antibody [NBP1-55156]

Western Blot: ACAA1 Antibody [NBP1-55156] - Human Fetal Brain tissue lysate at a concentration of 1ug/ml.
Western Blot: ACAA1 Antibody [NBP1-55156]

Western Blot: ACAA1 Antibody [NBP1-55156]

Western Blot: ACAA1 Antibody [NBP1-55156] - Human Liver cell lysate at 1:1000.
Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-55156]

Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-55156]

Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-55156] - Human Liver cell lysate tissue.

Applications for ACAA1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAA1

ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.Acetyl-Coenzyme A acyltransferase (ACAA1) is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal

Gene Symbol

ACAA1

UniProt

P09110 (Human)

Additional ACAA1 Products

Product Documents for ACAA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACAA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACAA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACAA1 Antibody - BSA Free and earn rewards!

Have you used ACAA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies