ACAT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89526

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACAT2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACAT2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ACAT2 Antibody [NBP1-89526]

Immunocytochemistry/ Immunofluorescence: ACAT2 Antibody [NBP1-89526]

Immunocytochemistry/Immunofluorescence: ACAT2 Antibody [NBP1-89526] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526] - Staining of human gastrointestinal, liver, skeletal muscle and testis using Anti-ACAT2 antibody NBP1-89526 (A) shows similar protein distribution across tissues to independent antibody NBP1-89525 (B).
ACAT2 Antibody - BSA Free Immunohistochemistry-Paraffin: ACAT2 Antibody - BSA Free [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody - BSA Free [NBP1-89526]

Analysis in human liver and skeletal muscle tissues using NBP1-89526 antibody. Corresponding ACAT2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526]

Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89526] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Applications for ACAT2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAT2

The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Long Name

Acetyl-CoA acetyltransferase, cytosolic

Alternate Names

ACTL, EC 2.3.1.9

Gene Symbol

ACAT2

Additional ACAT2 Products

Product Documents for ACAT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACAT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ACAT2 Antibody - BSA Free

Customer Reviews for ACAT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACAT2 Antibody - BSA Free and earn rewards!

Have you used ACAT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies