ACBD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35682

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACBD3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ACBD3 (NP_073572.2).

Sequence:
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit ACBD3 Antibody - BSA Free (NBP3-35682) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ACBD3 Antibody - BSA Free

ACBD3 Antibody

Western Blot: ACBD3 Antibody [NBP3-35682] -

Western Blot: ACBD3 Antibody [NBP3-35682] - Western blot analysis of various lysates using ACBD3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
ACBD3 Antibody

Immunocytochemistry/ Immunofluorescence: ACBD3 Antibody [NBP3-35682] -

Immunocytochemistry/ Immunofluorescence: ACBD3 Antibody [NBP3-35682] - Immunofluorescence analysis of L929 cells using ACBD3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ACBD3 Antibody

Immunocytochemistry/ Immunofluorescence: ACBD3 Antibody [NBP3-35682] -

Immunocytochemistry/ Immunofluorescence: ACBD3 Antibody [NBP3-35682] - Immunofluorescence analysis of C6 cells using ACBD3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ACBD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ACBD3

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Alternate Names

acyl-CoA binding domain containing 3, Acyl-CoA-binding domain-containing protein 3, acyl-Coenzyme A binding domain containing 3, GCP60Golgi phosphoprotein 1, GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7, golgi complex associated protein 1, 60kDa, Golgi complex-associated protein 1, Golgi resident protein GCP60, GOLPH1PBR- and PKA-associated protein 7, PAP7, PBR associated protein, peripherial benzodiazepine receptor associated protein, PKA (RIalpha)-associated protein

Gene Symbol

ACBD3

Additional ACBD3 Products

Product Documents for ACBD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACBD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACBD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACBD3 Antibody - BSA Free and earn rewards!

Have you used ACBD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies