Activin B/Inhibin beta B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24918

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Inhibin beta B using the following amino acid sequence: GWHTFPLTEAIQALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLECDGRTNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Activin B/Inhibin beta B Antibody - BSA Free

Activin B/Inhibin beta B Antibody Immunocytochemistry/Immunofluorescence: Activin B/Inhibin beta B Antibody [NBP3-24918]

Immunocytochemistry/Immunofluorescence: Activin B/Inhibin beta B Antibody [NBP3-24918]

Staining of human cell line MCF-7 shows localization to vesicles.

Applications for Activin B/Inhibin beta B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Activin B

Activin B is a TGF-beta superfamily cytokine that regulates cellular migration by inducing actin stress fiber formation. It signals through heterodimeric receptor complexes composed of type I (Activin RIA or RIB) and type II (Activin RIIA or RIIB) transmembrane Ser/Thr kinases. It also modulates signaling through E-Cadherin and Integrin beta 3. Activin B upregulation is associated with tumor cell adhesion, migration, and metastasis. It also promotes wound healing through increased cellular migration. Activin B additionally induces hair follicle formation and expression of Hepicin in the liver, but it inhibits lipolysis in adipocytes and glucose-stimulated calcium influx in pancreatic beta cells. Alterations of Activin B serum levels of Activin B are associated with ectopic pregnancy and chronic fatigue syndrome, and it is upregulated in alveolar epithelial cells in pulmonary fibrosis. 

 

Alternate Names

activin AB beta polypeptide, Activin beta-B chain, INHBB, inhibin beta B chain, inhibin, beta B, inhibin, beta B (activin AB beta polypeptide), Inhibin, beta-2

Gene Symbol

INHBB

Additional Activin B Products

Product Documents for Activin B/Inhibin beta B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Activin B/Inhibin beta B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Activin B/Inhibin beta B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Activin B/Inhibin beta B Antibody - BSA Free and earn rewards!

Have you used Activin B/Inhibin beta B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...