ACTL7B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86972

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACTL7B Antibody - BSA Free

ACTL7B Antibody - BSA Free Immunohistochemistry-Paraffin: ACTL7B Antibody - BSA Free [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody - BSA Free [NBP1-86972]

Analysis in human testis and kidney tissues Corresponding ACTL7B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human cerebral cortex, duodenum, kidney and testis using Anti-ACTL7B antibody NBP1-86972 (A) shows similar protein distribution across tissues to independent antibody NBP1-86973 (B).
Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972]

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human duodenum shows no positivity in glandular cells as expected.
ACTL7B Antibody - BSA Free Western Blot: ACTL7B Antibody - BSA Free [NBP1-86972]

Western Blot: ACTL7B Antibody - BSA Free [NBP1-86972]

Analysis in control (vector only transfected HEK293T lysate) and ACTL7B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for ACTL7B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACTL7B

ACTL7B is encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Alternate Names

actin-like 7B, actin-like 7-beta, actin-like protein 7B, Actin-like-7-beta, Tact1

Gene Symbol

ACTL7B

Additional ACTL7B Products

Product Documents for ACTL7B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACTL7B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACTL7B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACTL7B Antibody - BSA Free and earn rewards!

Have you used ACTL7B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...