ADAM12 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82791
![Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]](https://beta-resources.rndsystems.com/images/products/ADAM12-Antibody-Immunohistochemistry-Paraffin-NBP1-82791-img0010.jpg "Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23631827)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit ADAM12 Antibody - BSA Free (NBP1-82791) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-ADAM12 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for ADAM12 Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: ADAM12 Antibody [NBP1-82791]](https://beta-resources.rndsystems.com/images/products/ADAM12-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82791-img0004.jpg "Immunocytochemistry/ Immunofluorescence: ADAM12 Antibody [NBP1-82791]")
Immunocytochemistry/ Immunofluorescence: ADAM12 Antibody [NBP1-82791]
Immunocytochemistry/Immunofluorescence: ADAM12 Antibody [NBP1-82791] - Staining of human cell line A-431 shows localization to plasma membrane.![Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]](https://beta-resources.rndsystems.com/images/products/ADAM12-Antibody-Immunohistochemistry-Paraffin-NBP1-82791-img0008.jpg "Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]")
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.![Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]](https://beta-resources.rndsystems.com/images/products/ADAM12-Antibody-Immunohistochemistry-Paraffin-NBP1-82791-img0009.jpg "Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]")
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791]
Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791] - Staining of human placenta shows moderate positivity in trophoblastic cells.Applications for ADAM12 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ADAM12
Long Name
A Disintegrin and Metalloprotease-like Domain 12
Alternate Names
Meltrin alpha
Gene Symbol
ADAM12
Additional ADAM12 Products
Product Documents for ADAM12 Antibody - BSA Free
Product Specific Notices for ADAM12 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for ADAM12 Antibody - BSA Free
Powered by Bioz
Customer Reviews for ADAM12 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ADAM12 Antibody - BSA Free and earn rewards!
Have you used ADAM12 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...