ADAMTS17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56304

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADAMTS17 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS

Reactivity Notes

Mouse 88%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ADAMTS17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ADAMTS17 Antibody [NBP2-56304]

Immunocytochemistry/ Immunofluorescence: ADAMTS17 Antibody [NBP2-56304]

Immunocytochemistry/Immunofluorescence: ADAMTS17 Antibody [NBP2-56304] - Staining of human cell line HEK 293 shows localization to nucleus.

Applications for ADAMTS17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAMTS17

ADAMTS17 encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by ADAMTS19, another family member. The function of this protein has not been determined.

Alternate Names

A disintegrin and metalloproteinase with thrombospondin motifs 17, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 17, ADAM metallopeptidase with thrombospondin type 1 motif, 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, EC 3.4.24.82, FLJ16363, FLJ32769

Gene Symbol

ADAMTS17

Additional ADAMTS17 Products

Product Documents for ADAMTS17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAMTS17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADAMTS17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAMTS17 Antibody - BSA Free and earn rewards!

Have you used ADAMTS17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies