Adenine Nucleotide Translocase 1 Antibody (1U7X1)
Novus Biologicals | Catalog # NBP3-33484
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 1U7X1
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Adenine Nucleotide Translocase 1 (NP_001142.2).
Sequence:
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG
Sequence:
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Adenine Nucleotide Translocase 1 Antibody (1U7X1)
Western Blot: Adenine Nucleotide Translocase 1 Antibody (1U7X1) [NBP3-33484] -
Western Blot: Adenine Nucleotide Translocase 1 Antibody (1U7X1) [NBP3-33484] - Western Blot analysis of various lysates using [KO Validated] Adenine Nucleotide Translocase 1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Western Blot: Adenine Nucleotide Translocase 1 Antibody (1U7X1) [NBP3-33484] -
Western Blot: Adenine Nucleotide Translocase 1 Antibody (1U7X1) [NBP3-33484] - Western Blot analysis of lysates from wild type (WT) and Adenine Nucleotide Translocase 1 knockout (KO) 293T cells using [KO Validated] Adenine Nucleotide Translocase 1 Rabbit mAb at 1:1000 dilution.Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 30 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Applications for Adenine Nucleotide Translocase 1 Antibody (1U7X1)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Adenine Nucleotide Translocase 1
Alternate Names
AAC1, Adenine nucleotide translocator 1, ADP, ADP/ATP translocase 1, ANT 1, ANT1adenine nucleotide translocator 1 (skeletal muscle), ATP carrier protein 1, ATP carrier protein, heart/skeletal muscle, ATP carrier protein, heart/skeletal muscle isoform T1, heart/skeletal muscle ATP/ADP translocator, PEO2, PEO3, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4, Solute carrier family 25 member 4, T1ANT
Gene Symbol
SLC25A4
Additional Adenine Nucleotide Translocase 1 Products
Product Documents for Adenine Nucleotide Translocase 1 Antibody (1U7X1)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Adenine Nucleotide Translocase 1 Antibody (1U7X1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Adenine Nucleotide Translocase 1 Antibody (1U7X1)
There are currently no reviews for this product. Be the first to review Adenine Nucleotide Translocase 1 Antibody (1U7X1) and earn rewards!
Have you used Adenine Nucleotide Translocase 1 Antibody (1U7X1)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...