Adenylate Cyclase 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57976

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Adenylate Cyclase 5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF',)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Adenylate Cyclase 5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Adenylate Cyclase 5 Antibody [NBP2-57976]

Immunocytochemistry/ Immunofluorescence: Adenylate Cyclase 5 Antibody [NBP2-57976]

Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 5 Antibody [NBP2-57976] - Staining of human cell line MCF7 shows localization to intermediate filaments.

Applications for Adenylate Cyclase 5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenylate Cyclase 5

ADCY5, also known as Adenylate cyclase type 5, consists of a 1,261 amino acid long isoform that is 139 kDa and a shorter 911 amino acid isoform that is 103 kDa, and is involved in the encoding of a membrane-bound enzyme. This protein has also been shown to have interactions with ADCY2, GNAS, PRKACA, GNAI1, and PRKCA in the Signaling by FGFR, PKA activation in glucagon signaling, DAG and IP3 signaling, Regulation of Water Balance by Renal Aquaporins, and Opioid Signalling pathway. Disease research is currently being studied with relation to ADCY5 and pancreatitis, leukemia, precocious puberty, and immunodeficiency.

Long Name

Adenylate cyclase type 5

Alternate Names

AC5, ADCY5, Adenylyl cyclase 5

Gene Symbol

ADCY5

Additional Adenylate Cyclase 5 Products

Product Documents for Adenylate Cyclase 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adenylate Cyclase 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenylate Cyclase 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenylate Cyclase 5 Antibody - BSA Free and earn rewards!

Have you used Adenylate Cyclase 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies