ADPGK Antibody (1E4) - Azide and BSA Free

Novus Biologicals | Catalog # H00083440-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Knockout Validated, Western Blot, ELISA, Sandwich ELISA, Knockdown Validated

Cited:

Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1E4

Format

Azide and BSA Free
View all ADPGK Primary Antibodies »

Product Specifications

Immunogen

ADPGK (NP_112574, 425 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY

Specificity

ADPGK - ADP-dependent glucokinase

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for ADPGK Antibody (1E4) - Azide and BSA Free

Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in NIH/3T3.
Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - Analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi ( Cat # H00083440-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody (M01), clone 1E4 (Cat # H00083440-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4 Analysis of ADPGK expression in HeLa.
Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in PC-12.
Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in Raw 264.7.
Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01]

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - Analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody (M01), clone 1E4.Lane 1: ADPGK transfected lysate(54.1 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: ADPGK Antibody (1E4) [H00083440-M01] - Detection limit for recombinant GST tagged ADPGK is 0.3 ng/ml as a capture antibody.

Applications for ADPGK Antibody (1E4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. Knock Out Validation was reported in scientific literature (PMID: 23799003).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ADPGK

ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).[supplied by OMIM]

Alternate Names

ADP-dependent glucokinase, ADP-GKrbBP-35, ATP-dependent glucokinase, DKFZp434B195, EC 2.7.1.147,2610017G09Rik, RbBP-35

Entrez Gene IDs

83440 (Human)

Gene Symbol

ADPGK

UniProt

NP_112574 (Human)

Additional ADPGK Products

Product Documents for ADPGK Antibody (1E4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADPGK Antibody (1E4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ADPGK Antibody (1E4) - Azide and BSA Free

Customer Reviews for ADPGK Antibody (1E4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ADPGK Antibody (1E4) - Azide and BSA Free and earn rewards!

Have you used ADPGK Antibody (1E4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies