AFAP Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90216
![Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216]](https://resources.rndsystems.com/images/products/AFAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90216-img0008.jpg "Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRVEADAKR
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for AFAP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216]
Immunocytochemistry/Immunofluorescence: AFAP Antibody [NBP1-90216] - Staining of human cell line U-251 MG shows positivity in cytoplasm, actin filaments and focal adhesion sites. Antibody staining is shown in green.![AFAP Antibody - BSA Free Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]](https://resources.rndsystems.com/images/products/nbp1-90216_rabbit-polyclonal-afap-antibody-3052025104722.jpg "Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]")
![AFAP Antibody - BSA Free Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]](https://resources.rndsystems.com/images/products/nbp1-90216_rabbit-polyclonal-afap-antibody-295202516312213.jpg "Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]")
Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]
Staining of human colon shows strong cytoplasmic positivity in glandular cells.![AFAP Antibody - BSA Free Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]](https://resources.rndsystems.com/images/products/nbp1-90216_rabbit-polyclonal-afap-antibody-305202510114716.jpg "Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]")
Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]
Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.![AFAP Antibody - BSA Free Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]](https://resources.rndsystems.com/images/products/nbp1-90216_rabbit-polyclonal-afap-antibody-30520251015114.jpg "Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]")
Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]
Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.![AFAP Antibody - BSA Free Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]](https://resources.rndsystems.com/images/products/nbp1-90216_rabbit-polyclonal-afap-antibody-29520251524140.jpg "Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]")
Immunohistochemistry: AFAP Antibody - BSA Free [NBP1-90216]
Staining of human liver shows very weak positivity in hepatocytes as expected.![Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216]](https://resources.rndsystems.com/images/products/AFAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90216-img0009.jpg "Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216]")
Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216]
AFAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90216-img0009.jpg
Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216] -
Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216] - Effect of an ERK-specific inhibitor (SCH 772984) on phenotypic markers of EMT under hypoxia; DAPI (blue), vimentin (green, upper), alpha -SMA (green, lower), AFAP (red, upper), alpha -tubulin (red, lower). (A) Increased expression of AFAP under hypoxia for 12 h were reduced after the treatment of ERK inhibitors. (B) Increased expression of alpha -tubulin under hypoxia for 12 h were reduced after the treatment of ERK inhibitors. Results are representative of three independent experiments, scale bar = 50 µM. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31137604), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for AFAP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: AFAP
Long Name
Actin Filament-associated Protein, 110 kDa
Alternate Names
AFAP-110, AFAP1
Entrez Gene IDs
60312 (Human)
Gene Symbol
AFAP1
UniProt
Additional AFAP Products
Product Documents for AFAP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AFAP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for AFAP Antibody - BSA Free
Powered by Bioz
Customer Reviews for AFAP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review AFAP Antibody - BSA Free and earn rewards!
Have you used AFAP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...