AGPAT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38279

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AGPAT1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 204-283 of human AGPAT1 (NP_006402.1).

Sequence:
PIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AGPAT1 Antibody - BSA Free

AGPAT1 Antibody

Immunoprecipitation: AGPAT1 Antibody [NBP3-38279] -

Immunoprecipitation: AGPAT1 Antibody [NBP3-38279] - Immunoprecipitation analysis of 200 ug extracts of 293T cells, using 3 ug AGPAT1 antibody. Western blot was performed from the immunoprecipitate using AGPAT1 antibody at a dilution of 1:1000.
AGPAT1 Antibody

Western Blot: AGPAT1 Antibody [NBP3-38279] -

Western Blot: AGPAT1 Antibody [NBP3-38279] - Western blot analysis of various lysates using AGPAT1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for AGPAT1 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AGPAT1

AGPAT1 (1-acyl-sn-glycerol-3-phosphate acyltransferase alpha) is a 283 amino acid enzyme located in the endoplasmic reticulum that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Defects in this protein have been linked to aspergillosis, systemic lupus erythematosus, meningitides, lupus erythematosus, Alzheimer's disease, gastric cancer and tuberculosis.

Alternate Names

1-acylglycerol-3-phosphate O-acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase), 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha), 1-AGP acyltransferase 1, 1-AGPAT1, EC 2.3.1.51, G15, LPAATA, LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, Lysophosphatidic acid acyltransferase alpha, lysophospholipid acyltransferase, MGC4007,1-AGPAT 1, MGC5423, Protein G15

Gene Symbol

AGPAT1

Additional AGPAT1 Products

Product Documents for AGPAT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AGPAT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AGPAT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AGPAT1 Antibody - BSA Free and earn rewards!

Have you used AGPAT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies