AGPAT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92662

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AGPAT2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 199-278 of human AGPAT2 (NP_006403.2). IVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AGPAT2 Antibody - BSA Free

Western Blot: AGPAT2 AntibodyBSA Free [NBP2-92662]

Western Blot: AGPAT2 AntibodyBSA Free [NBP2-92662]

Western Blot: AGPAT2 Antibody [NBP2-92662] - Analysis of extracts of HT-29 cells, using AGPAT2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time
AGPAT2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: AGPAT2 Antibody - BSA Free [NBP2-92662] -

Immunocytochemistry/ Immunofluorescence: AGPAT2 Antibody - BSA Free [NBP2-92662] - Immunofluorescence analysis of HeLa cells using AGPAT2 antibody. Blue: DAPI for nuclear staining.

Applications for AGPAT2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AGPAT2

AGPAT2 encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Alternate Names

1-acylglycerol-3-phosphate O-acyltransferase 2, 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase, beta), 1-AGPAT 2,1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase-beta), 1-AGPAT2,1-AGP acyltransferase 2,1-acyl-sn-glycerol-3-phosphate acyltransferase beta, Berardinelli-Seip congenital lipodystrophy, BSCL, BSCL1, EC 2.3.1.51, LPAAB, LPAAT-beta, Lysophosphatidic acid acyltransferase beta, lysophosphatidic acid acyltransferase-beta

Gene Symbol

AGPAT2

Additional AGPAT2 Products

Product Documents for AGPAT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AGPAT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AGPAT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AGPAT2 Antibody - BSA Free and earn rewards!

Have you used AGPAT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies