AIF Antibody (5F0Y1)

Novus Biologicals | Catalog # NBP3-15759

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5F0Y1 expressed in HEK293
View all AIF Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 450-550 of human AIF (O95831). RRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AIF Antibody (5F0Y1)

Western Blot: AIF Antibody (5F0Y1) [NBP3-15759]

Western Blot: AIF Antibody (5F0Y1) [NBP3-15759]

Western Blot: AIF Antibody (5F0Y1) [NBP3-15759] - Western blot analysis of extracts of various cell lines, using AIF antibody (NBP3-15759) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
AIF Antibody (5F0Y1)

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] -

Immunohistochemistry: AIF Antibody (5F0Y1) [AIF] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using AIF Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for AIF Antibody (5F0Y1)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AIF

AIF, or apoptosis-inducing factor, is a flavoprotein localized to the mitochondrial membrane that plays a primary role in caspase-independent cell death, or apoptosis (1,2). AIF translocates to the nucleus when apoptosis is induced and causes mitochondria to release the apoptogenic proteins, cytochrome c and caspase-9. Apoptotic activity of AIF leads to chromatin condensation and DNA fragmentation (1). Similar to cytochrome c, AIF is a bifunctional protein with an oxidoreductase function and a second apoptogenic function. In contrast to cytochrome c, however, AIF acts in a caspase-independent fashion (2,3,4).

Long Name

Apoptosis Inducing Factor

Alternate Names

AIFM1, COXPD6, PDCD8

Gene Symbol

AIFM1

Additional AIF Products

Product Documents for AIF Antibody (5F0Y1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AIF Antibody (5F0Y1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Bcl-2 Proteins and Regulators

Customer Reviews for AIF Antibody (5F0Y1)

There are currently no reviews for this product. Be the first to review AIF Antibody (5F0Y1) and earn rewards!

Have you used AIF Antibody (5F0Y1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Apoptosis Signaling Pathway Apoptosis Signaling Pathway Thumbnail