AK3 Antibody (1D2) - Azide and BSA Free

Novus Biologicals | Catalog # H00050808-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1D2

Format

Azide and BSA Free
View all AK3 Primary Antibodies »

Product Specifications

Immunogen

AK3 (NP_057366, 25 a.a. ~ 86 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYS

Reactivity Notes

Human. Other species not tested.

Specificity

AK3 - adenylate kinase 3

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for AK3 Antibody (1D2) - Azide and BSA Free

Western Blot: AK3 Antibody (1D2) [H00050808-M01]

Western Blot: AK3 Antibody (1D2) [H00050808-M01]

Western Blot: AK3 Antibody (1D2) [H00050808-M01] - AK3 monoclonal antibody (M01), clone 1D2 Analysis of AK3 expression in HepG2.
Western Blot: AK3 Antibody (1D2) [H00050808-M01]

Western Blot: AK3 Antibody (1D2) [H00050808-M01]

Western Blot: AK3 Antibody (1D2) [H00050808-M01] - Analysis of AK3 expression in transfected 293T cell line by AK3 monoclonal antibody (M01), clone 1D2.Lane 1: AK3 transfected lysate(25.6 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: AK3 Antibody (1D2) [H00050808-M01] - Detection limit for recombinant GST tagged AK3 is approximately 0.03ng/ml as a capture antibody.

Applications for AK3 Antibody (1D2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: AK3

Adenylate kinase (AK; adenosine triphosphate-adenosine monophosphate [ATP-AMP] phospho-transferase, EC 2.7.4.3) is a ubiquitous monomeric enzyme involved energy metabolism of prokaryotic and eukaryotic cells. Three isozymes (AK1, AK2 and AK3) are characterized in vertebrates. AK1 is present in the cytosol of skeletal muscle, brain, and erythrocyte, while AK2 is localized in the intermembrane space of mitochondria of liver, kidney, spleen and heart. AK3, called GTP:AMP phosphotransferase, exists in the mitochondrial matrix of liver and heart. These isozymes contribute to homeostasis of the adenine nucleotide composition in the cell.

Long Name

GTP:AMP phosphotransferase AK3, mitochondrial

Alternate Names

Adenylate kinase 3, AK 3, AK3L1, AK6, AKL3L, EC 2.7.4.10

Entrez Gene IDs

50808 (Human)

Gene Symbol

AK3

OMIM

609290 (Human)

UniProt

NP_057366 (Human)

Additional AK3 Products

Product Documents for AK3 Antibody (1D2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AK3 Antibody (1D2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AK3 Antibody (1D2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review AK3 Antibody (1D2) - Azide and BSA Free and earn rewards!

Have you used AK3 Antibody (1D2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies