AK3 Antibody (1D2) - Azide and BSA Free
Novus Biologicals | Catalog # H00050808-M01
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA, Sandwich ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 1D2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
AK3 (NP_057366, 25 a.a. ~ 86 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYS
Reactivity Notes
Human. Other species not tested.
Specificity
AK3 - adenylate kinase 3
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Scientific Data Images for AK3 Antibody (1D2) - Azide and BSA Free
Western Blot: AK3 Antibody (1D2) [H00050808-M01]
Western Blot: AK3 Antibody (1D2) [H00050808-M01] - AK3 monoclonal antibody (M01), clone 1D2 Analysis of AK3 expression in HepG2.Western Blot: AK3 Antibody (1D2) [H00050808-M01]
Western Blot: AK3 Antibody (1D2) [H00050808-M01] - Analysis of AK3 expression in transfected 293T cell line by AK3 monoclonal antibody (M01), clone 1D2.Lane 1: AK3 transfected lysate(25.6 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: AK3 Antibody (1D2) [H00050808-M01] - Detection limit for recombinant GST tagged AK3 is approximately 0.03ng/ml as a capture antibody.
Applications for AK3 Antibody (1D2) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: AK3
Long Name
GTP:AMP phosphotransferase AK3, mitochondrial
Alternate Names
Adenylate kinase 3, AK 3, AK3L1, AK6, AKL3L, EC 2.7.4.10
Entrez Gene IDs
50808 (Human)
Gene Symbol
AK3
OMIM
609290 (Human)
UniProt
Additional AK3 Products
Product Documents for AK3 Antibody (1D2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AK3 Antibody (1D2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for AK3 Antibody (1D2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review AK3 Antibody (1D2) - Azide and BSA Free and earn rewards!
Have you used AK3 Antibody (1D2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...