alcohol dehydrogenase Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92180

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all alcohol dehydrogenase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Alcohol Dehydrogenase (NP_000658.1). IIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for alcohol dehydrogenase Antibody - Azide and BSA Free

alcohol dehydrogenase Antibody - Azide and BSA Free

Western Blot: alcohol dehydrogenase Antibody - Azide and BSA Free [NBP2-92180] -

Western Blot: alcohol dehydrogenase Antibody - Azide and BSA Free [NBP2-92180] - Western blot analysis of various lysates using alcohol dehydrogenase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for alcohol dehydrogenase Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase

ADH (alcohol dehydrogenase) family of proteins metabolize a variety of substances such as ethanol, retinal, other aliphatic alcohol, hydroxysteroids, and lipid peroxidation products. With the coenzyme NAD, ADH catalyzes the reversible conversion of organic alcohol to ketones or aldehydes. ADH play a major role in ethanol metabolism.

Alternate Names

ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1

Gene Symbol

ADH1A

Additional alcohol dehydrogenase Products

Product Documents for alcohol dehydrogenase Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for alcohol dehydrogenase Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for alcohol dehydrogenase Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review alcohol dehydrogenase Antibody - Azide and BSA Free and earn rewards!

Have you used alcohol dehydrogenase Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies