Aldolase A Antibody (2E6) - Azide and BSA Free

Novus Biologicals | Catalog # H00000226-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2E6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ALDOA (AAH10660.1, 21 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFP

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

ALDOA - aldolase A, fructose-bisphosphate (2E6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Aldolase A Antibody (2E6) - Azide and BSA Free

Western Blot: Aldolase A Antibody (2E6) [H00000226-M03]

Western Blot: Aldolase A Antibody (2E6) [H00000226-M03]

Western Blot: Aldolase A Antibody (2E6) [H00000226-M03] - Analysis of ALDOA expression in NIH/3T3 (Cat # L018V1).
Western Blot: Aldolase A Antibody (2E6) [H00000226-M03]

Western Blot: Aldolase A Antibody (2E6) [H00000226-M03]

Western Blot: Aldolase A Antibody (2E6) [H00000226-M03] - Analysis of ALDOA expression in HepG2 (Cat # L019V1).

Applications for Aldolase A Antibody (2E6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Aldolase A

This gene product, Aldolase A (fructose-bisphosphate aldolase) is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants which encode the same protein. [provided by RefSeq]

Alternate Names

ALDA, aldolase A, fructose-bisphosphate, EC 4.1.2.13, fructose-1,6-bisphosphate triosephosphate-lyase, fructose-bisphosphate aldolase A, GSD12, Lung cancer antigen NY-LU-1, MGC10942, MGC17716, MGC17767, Muscle-type aldolase

Entrez Gene IDs

226 (Human)

Gene Symbol

ALDOA

Additional Aldolase A Products

Product Documents for Aldolase A Antibody (2E6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aldolase A Antibody (2E6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aldolase A Antibody (2E6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Aldolase A Antibody (2E6) - Azide and BSA Free and earn rewards!

Have you used Aldolase A Antibody (2E6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...