ALG12 Antibody (5E3) - Azide and BSA Free

Novus Biologicals | Catalog # H00079087-M06

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 5E3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ALG12 (NP_077010, 369 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG

Specificity

ALG12 - asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for ALG12 Antibody (5E3) - Azide and BSA Free

Western Blot: ALG12 Antibody (5E3) [H00079087-M06]

Western Blot: ALG12 Antibody (5E3) [H00079087-M06]

Western Blot: ALG12 Antibody (5E3) [H00079087-M06] - Analysis of ALG12 expression in HeLa (Cat # L013V1).
Western Blot: ALG12 Antibody (5E3) [H00079087-M06]

Western Blot: ALG12 Antibody (5E3) [H00079087-M06]

Western Blot: ALG12 Antibody (5E3) [H00079087-M06] - Analysis of ALG12 expression in PC-12 (Cat # L012V1).
Sandwich ELISA: ALG12 Antibody (5E3) [H00079087-M06] - Detection limit for recombinant GST tagged ALG12 is approximately 0.3ng/ml as a capture antibody.

Applications for ALG12 Antibody (5E3) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ALG12

This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation.

Alternate Names

alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 12 homolog, CDG1G, dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase, EC 2.4.1.-, ECM39, hALG12, Mannosyltransferase ALG12 homolog, Membrane protein SB87, MGC111358, MGC3136, PP14673

Entrez Gene IDs

79087 (Human)

Gene Symbol

ALG12

OMIM

607143 (Human)

Additional ALG12 Products

Product Documents for ALG12 Antibody (5E3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALG12 Antibody (5E3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALG12 Antibody (5E3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ALG12 Antibody (5E3) - Azide and BSA Free and earn rewards!

Have you used ALG12 Antibody (5E3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...