ALOXE3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62727

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ALOXE3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS

Reactivity Notes

Mouse (86%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ALOXE3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727]

Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727]

Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727] - Analysis in human skin and kidney tissues using Anti-ALOXE3 antibody. Corresponding ALOXE3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727]

Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727]

Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727]

Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727]

Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP2-62727] - Staining of human kidney shows low expression as expected.

Applications for ALOXE3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALOXE3

The leukotrienes constitute a group of arachidonic acid-derived compounds with biologic activities suggesting important roles in inflammation and immediate hypersensitivity. These compounds are catabolized, in part, by lipoxygenases. Epidermis-type lipoxygenases, a distinct subclass within the multigene family of mammalian lipoxygenases, are novel isoenzymes isolated from human and mouse skin including human ALOX15B (MIM 603697), human and mouse ALOX12B (MIM 603741), mouse 8S-LOX, and mouse e-LOX-3.[supplied by OMIM]

Alternate Names

arachidonate lipoxygenase 3, EC 1.13.11.-, E-LOX, eLOX3, e-LOX-3, epidermal lipoxygenase, epidermis-type lipoxygenase 3, MGC119694, MGC119695, MGC119696

Gene Symbol

ALOXE3

Additional ALOXE3 Products

Product Documents for ALOXE3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALOXE3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALOXE3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALOXE3 Antibody - BSA Free and earn rewards!

Have you used ALOXE3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies