alpha Adducin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38268

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha Adducin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: alpha Adducin Antibody [NBP2-38268]

Immunocytochemistry/ Immunofluorescence: alpha Adducin Antibody [NBP2-38268]

Immunocytochemistry/Immunofluorescence: alpha Adducin Antibody [NBP2-38268] - Staining of human cell line U-2 OS shows localization to nuclear bodies & plasma membrane.
Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268] - Staining of human colon.
Immunohistochemistry: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry: alpha Adducin Antibody [NBP2-38268] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268] - Staining of human cerebral cortex, colon, kidney and testis using Anti-ADD1 antibody NBP2-38268 (A) shows similar protein distribution across tissues to independent antibody NBP2-38269 (B).
Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268] - Staining of human testis.
Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268]

Immunohistochemistry-Paraffin: alpha Adducin Antibody [NBP2-38268] - Staining of human kidney.

Applications for alpha Adducin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha Adducin

Adducin is a membrane skeletal protein that binds to actin filaments (F-actin) and promotes the association of spectrin with F-actin to form a spectrin-actin meshwork beneath plasma membranes (1-2). Adducin is a heterodimeric protein that consists of related subunits; alpha and beta, or alpha and gamma subunits (3). Adducin binds with high affinity to Ca(2+)/calmodulin and is a substrate for protein kinase C (PKC), and protein kinase A (PKA) (4). PKA specifically phosphorylates Ser408, Ser436, and Ser481 located in the neck domain of alpha Adducin. Phosphorylation of Adducin alpha by Rho-kinase at Thr445 and Thr480 enhances the F-actin-binding activity of Adducin alpha (5).

Alternate Names

ADDA, adducin 1 (alpha), alpha-adducin, erythrocyte adducin alpha subunit, Erythrocyte adducin subunit alpha, MGC3339, MGC44427

Gene Symbol

ADD1

UniProt

Additional alpha Adducin Products

Product Documents for alpha Adducin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha Adducin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha Adducin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha Adducin Antibody - BSA Free and earn rewards!

Have you used alpha Adducin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...