alpha-Galactosidase A/GLA Antibody (7G8T9)

Novus Biologicals | Catalog # NBP3-16563

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7G8T9 expressed in HEK293
View all alpha-Galactosidase A/GLA Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human alpha-Galactosidase A/GLA (GLA) (P06280). FMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for alpha-Galactosidase A/GLA Antibody (7G8T9)

Western Blot: alpha-Galactosidase A/GLA Antibody (7G8T9) [NBP3-16563]

Western Blot: alpha-Galactosidase A/GLA Antibody (7G8T9) [NBP3-16563]

Western Blot: alpha-Galactosidase A/GLA Antibody (7G8T9) [NBP3-16563] - Analysis of extracts of various cell lines, using alpha-Galactosidase A/GLA (GLA) Rabbit mAb (NBP3-16563) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for alpha-Galactosidase A/GLA Antibody (7G8T9)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha-Galactosidase A/GLA

Galactosidase alpha encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. [provided by RefSeq]

Alternate Names

Agalsidase alpha, GALA, Melibiase

Gene Symbol

GLA

Additional alpha-Galactosidase A/GLA Products

Product Documents for alpha-Galactosidase A/GLA Antibody (7G8T9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for alpha-Galactosidase A/GLA Antibody (7G8T9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha-Galactosidase A/GLA Antibody (7G8T9)

There are currently no reviews for this product. Be the first to review alpha-Galactosidase A/GLA Antibody (7G8T9) and earn rewards!

Have you used alpha-Galactosidase A/GLA Antibody (7G8T9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies