ALS2CR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90183

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ALS2CR2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ALS2CR2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ALS2CR2 Antibody [NBP1-90183]

Immunocytochemistry/ Immunofluorescence: ALS2CR2 Antibody [NBP1-90183]

Immunocytochemistry/Immunofluorescence: ALS2CR2 Antibody [NBP1-90183] - Staining of human cell line U-2 OS shows localization to cytosol & aggresome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALS2CR2 Antibody [NBP1-90183]

Immunohistochemistry-Paraffin: ALS2CR2 Antibody [NBP1-90183]

Immunohistochemistry-Paraffin: ALS2CR2 Antibody [NBP1-90183] - Staining of human pancreas shows moderate to strong positivity in islets of Langerhans.
ALS2CR2 Antibody - BSA Free Immunohistochemistry: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Immunohistochemistry: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Staining of human lymph node shows weak to moderate positivity in non-germinal center cells.
ALS2CR2 Antibody - BSA Free Immunohistochemistry: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Immunohistochemistry: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
ALS2CR2 Antibody - BSA Free Immunohistochemistry: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Immunohistochemistry: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.
ALS2CR2 Antibody - BSA Free Western Blot: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Western Blot: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
ALS2CR2 Antibody - BSA Free Western Blot: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Western Blot: ALS2CR2 Antibody - BSA Free [NBP1-90183]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for ALS2CR2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALS2CR2

ALS2CR2 encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. [provided by RefSeq]

Alternate Names

ALS2CR2candidate 2, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein, CALS-21MGC102916, ILP-interacting protein, ILPIPSTRAD beta, Pseudokinase ALS2CR2, STE20-related kinase adaptor beta

Entrez Gene IDs

55437 (Human)

Gene Symbol

STRADB

UniProt

Q9C0K7 (Human)

Additional ALS2CR2 Products

Product Documents for ALS2CR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALS2CR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALS2CR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALS2CR2 Antibody - BSA Free and earn rewards!

Have you used ALS2CR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies