AMIGO Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14287

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AMIGO Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: SSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AMIGO Antibody - BSA Free

Western Blot: AMIGO Antibody [NBP2-14287]

Western Blot: AMIGO Antibody [NBP2-14287]

Western Blot: AMIGO Antibody [NBP2-14287] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: AMIGO Antibody [NBP2-14287]

Immunocytochemistry/ Immunofluorescence: AMIGO Antibody [NBP2-14287]

Immunocytochemistry/Immunofluorescence: AMIGO Antibody [NBP2-14287] - Staining of human cell line BJ shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: AMIGO Antibody [NBP2-14287]

Immunohistochemistry-Paraffin: AMIGO Antibody [NBP2-14287]

Immunohistochemistry-Paraffin: AMIGO Antibody [NBP2-14287] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Applications for AMIGO Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AMIGO

Promotes growth and fasciculation of neurites from cultured hippocampal neurons. May be involved infasciculation as well as myelination of developing neural axons. May have a role in regeneration as well as neuralplasticity in the adult nervous system. May mediate homophilic as well as heterophilic cell-cell interaction andcontribute to signal transduction through its intracellular domain

Long Name

Amphoterin-induced Gene and ORF

Alternate Names

ali2, Alivin-2, AMIGO1

Entrez Gene IDs

57463 (Human)

Gene Symbol

AMIGO1

UniProt

Q86WK6

Additional AMIGO Products

Product Documents for AMIGO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AMIGO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AMIGO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMIGO Antibody - BSA Free and earn rewards!

Have you used AMIGO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies