Aminoacylase/ACY1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25276

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (95%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aminoacylase/ACY1 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Aminoacylase/ACY1 using the following amino acid sequence: SSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aminoacylase/ACY1 Antibody - BSA Free

Aminoacylase/ACY1 Antibody Immunocytochemistry/Immunofluorescence: Aminoacylase/ACY1 Antibody [NBP3-25276]

Immunocytochemistry/Immunofluorescence: Aminoacylase/ACY1 Antibody [NBP3-25276]

Staining of human cell line Hep-G2 shows localization to vesicles.
Aminoacylase/ACY1 Antibody Western Blot: Aminoacylase/ACY1 Antibody [NBP3-25276]

Western Blot: Aminoacylase/ACY1 Antibody [NBP3-25276]

Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Applications for Aminoacylase/ACY1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml

Western Blot

0.04-0.4 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aminoacylase/ACY1

Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes.

Alternate Names

ACY1

Gene Symbol

ACY1

Additional Aminoacylase/ACY1 Products

Product Documents for Aminoacylase/ACY1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aminoacylase/ACY1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for Aminoacylase/ACY1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aminoacylase/ACY1 Antibody - BSA Free and earn rewards!

Have you used Aminoacylase/ACY1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies