Amylin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33680

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Amylin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Amylin Antibody - BSA Free

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining in human pancreas and skeletal muscle tissues. Corresponding IAPP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human kidney shows no positivity in cells in tubules and cells in glomeruli as expected.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680]

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Applications for Amylin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Amylin

Amylin is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the association of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Recent results suggest that amylin, like the related beta amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.

Alternate Names

AMYLIN, DAPamylin, Diabetes-associated peptide, IAP, Insulinoma amyloid peptide, islet amyloid polypeptide, Islet amyloid polypeptide (diabetes-associated peptide; amylin)

Gene Symbol

IAPP

UniProt

P10997 (Human)

Additional Amylin Products

Product Documents for Amylin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Amylin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Amylin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Amylin Antibody - BSA Free and earn rewards!

Have you used Amylin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies