ANKLE2 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-92367
![Western Blot: ANKLE2 AntibodyAzide and BSA Free [NBP2-92367]](https://resources.rndsystems.com/images/products/ANKLE2-Antibody-Western-Blot-NBP2-92367-img0001.jpg "Western Blot: ANKLE2 AntibodyAzide and BSA Free [NBP2-92367]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1). CRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
104 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ANKLE2 Antibody - Azide and BSA Free
Western Blot: ANKLE2 AntibodyAzide and BSA Free [NBP2-92367]
Western Blot: ANKLE2 Antibody [NBP2-92367] - Analysis of extracts of various cell lines, using ANKLE2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.![Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]](https://resources.rndsystems.com/images/products/ANKLE2-Antibody-Immunohistochemistry-Paraffin-NBP2-92367-img0004.jpg "Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]")
Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]
Immunohistochemistry-Paraffin: ANKLE2 Antibody [NBP2-92367] - Immunohistochemistry of paraffin-embedded Human lung cancer using ANKLE2 Rabbit pAb (NBP2-92367) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]](https://resources.rndsystems.com/images/products/ANKLE2-Antibody-Immunohistochemistry-Paraffin-NBP2-92367-img0002.jpg "Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]")
Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]
Immunohistochemistry-Paraffin: ANKLE2 Antibody [NBP2-92367] - Immunohistochemistry of paraffin-embedded Mouse kidney using ANKLE2 Rabbit pAb (NBP2-92367) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]](https://resources.rndsystems.com/images/products/ANKLE2-Antibody-Immunohistochemistry-Paraffin-NBP2-92367-img0003.jpg "Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]")
Immunohistochemistry-Paraffin: ANKLE2 Antibody - Azide and BSA Free [NBP2-92367]
Immunohistochemistry-Paraffin: ANKLE2 Antibody [NBP2-92367] - Immunohistochemistry of paraffin-embedded Rat testis using ANKLE2 Rabbit pAb (NBP2-92367) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Applications for ANKLE2 Antibody - Azide and BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunohistochemistry
1:50-1:200
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ANKLE2
Alternate Names
ankyrin repeat and LEM domain containing 2, ankyrin repeat and LEM domain-containing protein 2, FLJ22280, FLJ36132, KIAA0692, LEM domain containing 7, LEMD7
Gene Symbol
ANKLE2
Additional ANKLE2 Products
Product Documents for ANKLE2 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ANKLE2 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for ANKLE2 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ANKLE2 Antibody - Azide and BSA Free and earn rewards!
Have you used ANKLE2 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...