ANKRD26 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82937

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ANKRD26 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DNAKLKVTVKKQMDKIEELQKNLLNANLSEDEKEQLKKLMELKQSLECNLDQEMKKNVELEREITGFKNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ANKRD26 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ANKRD26 Antibody [NBP1-82937]

Immunocytochemistry/ Immunofluorescence: ANKRD26 Antibody [NBP1-82937]

Immunocytochemistry/Immunofluorescence: ANKRD26 Antibody [NBP1-82937] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: ANKRD26 Antibody [NBP1-82937]

Immunohistochemistry-Paraffin: ANKRD26 Antibody [NBP1-82937]

Immunohistochemistry-Paraffin: ANKRD26 Antibody [NBP1-82937] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Applications for ANKRD26 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ANKRD26

The ANKRD26 (ankyrin repeat domain 26) gene has been implicated to give rise to the POTE gene family which encode proteins containing ankyrin repeats and coiled -coil domains. The generation of mice that bear mutant AKFRD26 indicates that ANKRD26 plays a role in obesity, insulin resistance, and body size. ANKRD26 is also known as KIAA1074. Yes-associated protein 1 (YAP1) is the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [from NCBI GeneID:10413]

Alternate Names

ankyrin repeat domain 26, ankyrin repeat domain-containing protein 26, bA145E8.1, KIAA1074MGC163325

Gene Symbol

ANKRD26

Additional ANKRD26 Products

Product Documents for ANKRD26 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ANKRD26 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANKRD26 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ANKRD26 Antibody - BSA Free and earn rewards!

Have you used ANKRD26 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANKRD26 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Is the antibody code. NBP1-82937 suitable for whole blood samples?

    A: Our ANKRD26 antibody with catalogue number NBP1-82937 has been validated for IHC with paraffin-embedded human tissue samples, and it has also been validated for immunofluorescence; other species and applications have not yet been tested. The immunocytochemistry application was validated using plated A-431 cells, which are an adherent epidermoid carcinoma line. We do not routinely test our antibodies with samples of whole blood, and unfortunately we have no testing data to confirm whether this particular antibody would work in such an experimental set up. Should you be analysing your whole blood samples by flow cytometry, please note that NBP1-82937 has not yet been tested for flow.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies