Annexin A11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90160

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Annexin A11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Annexin A11 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Annexin A11 Antibody [NBP1-90160]

Immunocytochemistry/ Immunofluorescence: Annexin A11 Antibody [NBP1-90160]

Immunocytochemistry/Immunofluorescence: Annexin A11 Antibody [NBP1-90160] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160]

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160]

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160]

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160]

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160]

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160]

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Annexin A11 Antibody - BSA Free Immunohistochemistry: Annexin A11 Antibody - BSA Free [NBP1-90160]

Immunohistochemistry: Annexin A11 Antibody - BSA Free [NBP1-90160]

Staining of human pancreas shows strong cytoplasmic positivity in intercalated ducts.
Annexin A11 Antibody - BSA Free Western Blot: Annexin A11 Antibody - BSA Free [NBP1-90160]

Western Blot: Annexin A11 Antibody - BSA Free [NBP1-90160]

Analysis in human cell line PC-3.

Applications for Annexin A11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Annexin A11

Annexin A11 is a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain the calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Transcript variants encoding the same isoform have been identified.

Alternate Names

ANXA11, CAP50

Entrez Gene IDs

311 (Human)

Gene Symbol

ANXA11

UniProt

P50995

Additional Annexin A11 Products

Product Documents for Annexin A11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Annexin A11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Annexin A11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Annexin A11 Antibody - BSA Free and earn rewards!

Have you used Annexin A11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies