Annexin A2 Antibody (1W2B5)

Novus Biologicals | Catalog # NBP3-15360

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1W2B5 expressed in HEK293
View all Annexin A2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A2 (P07355). MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Annexin A2 Antibody (1W2B5) (NBP3-15360) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Annexin A2 Antibody (1W2B5)

Western Blot: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Western Blot: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Western Blot: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Western blot analysis of extracts of various cell lines, using Annexin A2 Rabbit mAb (NBP3-15360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded mouse testis using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded rat ovary using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded human esophageal using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Annexin A2 Antibody (1W2B5)

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Annexin A2 Antibody (1W2B5)

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Annexin A2 Antibody (1W2B5)

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Annexin A2 Antibody (1W2B5)

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Annexin A2 Antibody (1W2B5)

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Annexin A2 Antibody (1W2B5)

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Annexin A2 Antibody (1W2B5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Annexin A2

The Annexins are a family of structurally similar proteins. Annexins bind to phospholipids and may be involved in regulation of membrane transport, membrane channel activity, and interaction of the cell membrane with the extracellular matrix. Annexin II is a calcium regulated, membrane binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ANX2L4, ANXA2, CAL1H, LIP2, Lipocortin-2, LPC2D, PAP-IV

Gene Symbol

ANXA2

Additional Annexin A2 Products

Product Documents for Annexin A2 Antibody (1W2B5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Annexin A2 Antibody (1W2B5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Annexin A2 Antibody (1W2B5)

There are currently no reviews for this product. Be the first to review Annexin A2 Antibody (1W2B5) and earn rewards!

Have you used Annexin A2 Antibody (1W2B5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies