Annexin A2 Antibody (1W2B5)
Novus Biologicals | Catalog # NBP3-15360
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 1W2B5 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A2 (P07355). MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit Annexin A2 Antibody (1W2B5) (NBP3-15360) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Annexin A2 Antibody (1W2B5)
Western Blot: Annexin A2 Antibody (1W2B5) [NBP3-15360]
Western Blot: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Western blot analysis of extracts of various cell lines, using Annexin A2 Rabbit mAb (NBP3-15360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]
Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded mouse testis using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]
Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded rat ovary using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360]
Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded human esophageal using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -
Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -
Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -
Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -
Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -
Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] -
Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Applications for Annexin A2 Antibody (1W2B5)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Annexin A2
Alternate Names
ANX2L4, ANXA2, CAL1H, LIP2, Lipocortin-2, LPC2D, PAP-IV
Gene Symbol
ANXA2
Additional Annexin A2 Products
Product Documents for Annexin A2 Antibody (1W2B5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Annexin A2 Antibody (1W2B5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Annexin A2 Antibody (1W2B5)
There are currently no reviews for this product. Be the first to review Annexin A2 Antibody (1W2B5) and earn rewards!
Have you used Annexin A2 Antibody (1W2B5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...