ANP32B Antibody (4A8E5)

Novus Biologicals | Catalog # NBP3-16199

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4A8E5 expressed in HEK293
View all ANP32B Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ANP32B (Q92688). MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ANP32B Antibody (4A8E5)

Western Blot: ANP32B Antibody (4A8E5) [NBP3-16199]

Western Blot: ANP32B Antibody (4A8E5) [NBP3-16199]

Western Blot: ANP32B Antibody (4A8E5) [NBP3-16199] - Western blot analysis of extracts of various cell lines, using ANP32B Rabbit mAb (NBP3-16199) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
ANP32B Antibody (4A8E5)

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded rat liver tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ANP32B Antibody (4A8E5)

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] - Confocal imaging of C6 cells using ANP32B Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ANP32B Antibody (4A8E5)

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded rat lung tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ANP32B Antibody (4A8E5)

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded human liver tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ANP32B Antibody (4A8E5)

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded human thyroid tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ANP32B Antibody (4A8E5)

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded human esophagus tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ANP32B Antibody (4A8E5)

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded mouse liver tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ANP32B Antibody (4A8E5)

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] - Confocal imaging of paraffin-embedded Mouse colon tissue using ANP32B Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ANP32B Antibody (4A8E5)

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] -

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded mouse heart tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for ANP32B Antibody (4A8E5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ANP32B

Multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. Required for the progression from the G1 to the S phase. Anti-apoptotic protein which functions as a caspase-3 inhibitor. Has no phosphatase 2A (PP2A) inhibitor activity

Alternate Names

acidic (leucine-rich) nuclear phosphoprotein 32 family, member B, acidic leucine-rich nuclear phosphoprotein 32 family member B, Acidic protein rich in leucines, APRILSilver-stainable protein SSP29, Pal31, PHAPI2SSP29, Putative HLA-DR-associated protein I-2

Gene Symbol

ANP32B

Additional ANP32B Products

Product Documents for ANP32B Antibody (4A8E5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ANP32B Antibody (4A8E5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANP32B Antibody (4A8E5)

There are currently no reviews for this product. Be the first to review ANP32B Antibody (4A8E5) and earn rewards!

Have you used ANP32B Antibody (4A8E5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies