APH1A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92623

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all APH1A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human APH1A (NP_001071096.1). TSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit APH1A Antibody - Azide and BSA Free (NBP2-92623) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for APH1A Antibody - Azide and BSA Free

Western Blot: APH1A AntibodyAzide and BSA Free [NBP2-92623]

Western Blot: APH1A AntibodyAzide and BSA Free [NBP2-92623]

Western Blot: APH1A Antibody [NBP2-92623] - Analysis of extracts of various cell lines, using APH1A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: APH1A Antibody - Azide and BSA Free [NBP2-92623]

Immunocytochemistry/ Immunofluorescence: APH1A Antibody - Azide and BSA Free [NBP2-92623]

Immunocytochemistry/Immunofluorescence: APH1A Antibody [NBP2-92623] - Analysis of L929 cells using APH1A. Blue: DAPI for nuclear staining.

Applications for APH1A Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: APH1A

Anterior Pharynx Defective 1 (APH1a) is an integral transmembrane protein forming a component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. The gamma-secretase complex is an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein).

Long Name

gamma-Secretase Subunit Anterior Pharynx Defective 1 Homolog A

Alternate Names

6530402N02Rik, anterior pharynx defective 1 homolog A (C. elegans), APH-1, APH-1A, Aph-1alpha, CGI-78, gamma-secretase subunit APH-1A, Presenilin-stabilization factor, PSF

Gene Symbol

APH1A

Additional APH1A Products

Product Documents for APH1A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for APH1A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for APH1A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review APH1A Antibody - Azide and BSA Free and earn rewards!

Have you used APH1A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies