Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)
Novus Biologicals | Catalog # NBP3-16872
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 0V1R8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 864-963 of human Apolipoprotein E R2/ApoE R2 (Q14114). PVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)
Western Blot: Apolipoprotein E R2/ApoE R2 Antibody (0V1R8) [NBP3-16872]
Western Blot: Apolipoprotein E R2/ApoE R2 Antibody (0V1R8) [NBP3-16872] - Western blot analysis of extracts of various cell lines, using Apolipoprotein E R2/ApoE R2 Rabbit mAb (NBP3-16872) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Applications for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Apolipoprotein E R2/ApoE R2
ApoER2 is expressed mainly in the brain, placenta, platelets and megakaryocytic cells, but not in the liver. LRP8 mutations can cause myocardial infarction type 1 (MCI1), a condition characterized by the irreversible necrosis of heart muscle secondary to prolonged ischemia. ApoER2 may also play a role in debilitating neurodegenerative diseases such as schizophrenia and Alzheimer's disease.
ApoER2 antibodies are useful tools for studying certian cardiac and neurodegenerative diseases.
Long Name
Apolipoprotein E Receptor 2
Alternate Names
ApoER2, Lr8b, LRP-8, LRP8
Gene Symbol
LRP8
Additional Apolipoprotein E R2/ApoE R2 Products
Product Documents for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)
There are currently no reviews for this product. Be the first to review Apolipoprotein E R2/ApoE R2 Antibody (0V1R8) and earn rewards!
Have you used Apolipoprotein E R2/ApoE R2 Antibody (0V1R8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...