Aquaporin-5 Antibody (10V2Y1)

Novus Biologicals | Catalog # NBP3-33420

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 10V2Y1
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 165-265 of human Aquaporin-5 (NP_001642.1).

Sequence:
IGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aquaporin-5 Antibody (10V2Y1)

Aquaporin-5 Antibody (10V2Y1)

Western Blot: Aquaporin-5 Antibody (10V2Y1) [NBP3-33420] -

Western Blot: Aquaporin-5 Antibody (10V2Y1) [NBP3-33420] - Western blot analysis of various lysates, using Aquaporin-5 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Aquaporin-5 Antibody (10V2Y1)

Western Blot: Aquaporin-5 Antibody (10V2Y1) [NBP3-33420] -

Western Blot: Aquaporin-5 Antibody (10V2Y1) [NBP3-33420] - Western blot analysis of various lysates, using Aquaporin-5 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for Aquaporin-5 Antibody (10V2Y1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aquaporin 5/AQP5

Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.

Long Name

Aquaporin 5

Alternate Names

AQP-5, AQP5, PPKB

Gene Symbol

AQP5

Additional Aquaporin 5/AQP5 Products

Product Documents for Aquaporin-5 Antibody (10V2Y1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin-5 Antibody (10V2Y1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Aquaporin-5 Antibody (10V2Y1)

There are currently no reviews for this product. Be the first to review Aquaporin-5 Antibody (10V2Y1) and earn rewards!

Have you used Aquaporin-5 Antibody (10V2Y1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...