ARHGAP28 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84640

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGL

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARHGAP28 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ARHGAP28 Antibody [NBP1-84640]

Immunocytochemistry/ Immunofluorescence: ARHGAP28 Antibody [NBP1-84640]

Immunocytochemistry/Immunofluorescence: ARHGAP28 Antibody [NBP1-84640] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions.
Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84640]

Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84640]

Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84640] - Staining of human testis shows high expression.
ARHGAP28 Antibody - BSA Free Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Analysis in human testis and tonsil tissues using HPA030413 antibody. Corresponding ARHGAP28 RNA-seq data are presented for the same tissues.
ARHGAP28 Antibody - BSA Free Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
ARHGAP28 Antibody - BSA Free Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
ARHGAP28 Antibody - BSA Free Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Immunohistochemistry-Paraffin: ARHGAP28 Antibody - BSA Free [NBP1-84640]

Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Applications for ARHGAP28 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARHGAP28

The ARHGAP28 gene encodes for a Rho GTPase-activating protein 28 that converts them to an inactive GDP-bound state. ARHGAP28 exists in four isoforms: isoform 1 is 729 amino acids long, 82 kDA; isoform 2 is 670 amino acids long, 75 kDA; isoform 3 is 545 amino acids long, nearly 62 kDA; isoform 5 is 570 amino acids long, 64 kDA (note, there is no isoform 4). ARHGAP28 functions in signal transduction and Rho GTPase cycle and has been investigated in various diseases such as benign meningioma.

Alternate Names

DKFZp686A2038, FLJ10312, KIAA1314FLJ27160, Rho GTPase activating protein 28, rho GTPase-activating protein 28, Rho-type GTPase-activating protein 28

Entrez Gene IDs

79822 (Human)

Gene Symbol

ARHGAP28

UniProt

Additional ARHGAP28 Products

Product Documents for ARHGAP28 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARHGAP28 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARHGAP28 Antibody - BSA Free

Customer Reviews for ARHGAP28 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP28 Antibody - BSA Free and earn rewards!

Have you used ARHGAP28 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...