ARID2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57220

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARID2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDITQQDTAKGD

Reactivity Notes

Mouse 86%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARID2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ARID2 Antibody [NBP2-57220]

Immunocytochemistry/ Immunofluorescence: ARID2 Antibody [NBP2-57220]

Immunocytochemistry/Immunofluorescence: ARID2 Antibody [NBP2-57220] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Applications for ARID2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARID2

The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. SWI/SNF complexes possess ATPase and DNA helicase activity that promotes transcriptional activation of genes normally repressed by chromatin structure. ARID2 (AT-rich interactive domain-containing protein 2) is also known as BAF200 and was purified as a factor that associated with PBAF (hSWI/SNF-B). ARID2 is a noncatalytic subunit that is a member of the ARID (AT-rich interactive domain-containing protein) family of DNA binding proteins. In addition to the ARID domain, ARID2 also contains a C2H2-type zinc finger and has been implicated as a transcriptional co-activator for serum response factor for the regulation of cardiac genes.

Alternate Names

ARID domain-containing protein 2, AT rich interactive domain 2 (ARID, RFX-like), BAF200KIAA1557AT-rich interactive domain-containing protein 2, BRG1-associated factor 200, DKFZp686G052, DKFZp779P0222, FLJ30619, p200, Zinc finger protein with activation potential, zipzap, zipzap/p200

Gene Symbol

ARID2

Additional ARID2 Products

Product Documents for ARID2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARID2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARID2 Antibody - BSA Free

Customer Reviews for ARID2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARID2 Antibody - BSA Free and earn rewards!

Have you used ARID2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies