ARL6IP4 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-04956
![Immunohistochemistry-Paraffin: ARL6IP4 Antibody - Azide and BSA Free [NBP3-04956]](https://resources.rndsystems.com/images/products/ARL6IP4-Antibody-Immunohistochemistry-Paraffin-NBP3-04956-img0001.jpg "Immunohistochemistry-Paraffin: ARL6IP4 Antibody - Azide and BSA Free [NBP3-04956]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3). SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ARL6IP4 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin: ARL6IP4 Antibody - Azide and BSA Free [NBP3-04956]
Immunohistochemistry-Paraffin: ARL6IP4 Antibody [NBP3-04956] - Paraffin-embedded human lung using ARL6IP4 antibody at dilution of 1:100 (40x lens).![Immunohistochemistry-Paraffin: ARL6IP4 Antibody - Azide and BSA Free [NBP3-04956]](https://resources.rndsystems.com/images/products/ARL6IP4-Antibody-Immunohistochemistry-Paraffin-NBP3-04956-img0002.jpg "Immunohistochemistry-Paraffin: ARL6IP4 Antibody - Azide and BSA Free [NBP3-04956]")
Immunohistochemistry-Paraffin: ARL6IP4 Antibody - Azide and BSA Free [NBP3-04956]
Immunohistochemistry-Paraffin: ARL6IP4 Antibody [NBP3-04956] - Paraffin-embedded human breast cancer using ARL6IP4 antibody at dilution of 1:100 (40x lens).Applications for ARL6IP4 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50-1:200
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ARL6IP4
Alternate Names
ADP-ribosylation-like factor 6 interacting protein 4, Aip-4, ARL-6-interacting protein 4, HSP-975, HSVI binding protein, HSVI-binding protein, MGC814, SFRS20, splicing factor, arginine/serine-rich 20, splicing regulator SRrp38, SR-15, SR-25ADP-ribosylation factor-like protein 6-interacting protein 4, SRp25 nuclear protein, SRp25aip-4, SRrp37
Gene Symbol
ARL6IP4
Additional ARL6IP4 Products
Product Documents for ARL6IP4 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ARL6IP4 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for ARL6IP4 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ARL6IP4 Antibody - Azide and BSA Free and earn rewards!
Have you used ARL6IP4 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...