ARMER Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91681

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARMER Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARMER Antibody - BSA Free

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681]

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681]

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681]

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681]

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
ARMER Antibody - BSA Free Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
ARMER Antibody - BSA Free Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
ARMER Antibody - BSA Free Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
ARMER Antibody - BSA Free Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Immunohistochemistry: ARMER Antibody - BSA Free [NBP1-91681]

Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Applications for ARMER Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARMER

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity (3), although the mechanism for this remains unkown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Alternate Names

ADP-ribosylation factor-like 6 interacting protein, ADP-ribosylation factor-like 6 interacting protein 1, AIP1, Aip-1, apoptotic regulator in the membrane of the endoplasmic reticulum, ARL-6-interacting protein 1, ARL6IPaip-1, ARMER, KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Entrez Gene IDs

23204 (Human)

Gene Symbol

ARL6IP1

UniProt

Q15041 (Human)

Additional ARMER Products

Product Documents for ARMER Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARMER Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARMER Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARMER Antibody - BSA Free and earn rewards!

Have you used ARMER Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies